PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00083992001
Common NameGSBRNA2T00083992001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family G2-like
Protein Properties Length: 218aa    MW: 25421.9 Da    PI: 6.0976
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00083992001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like95.15.4e-301367155
              G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                         kprlrW+ eLH+rF++av+qLGG++kAtPk ++++++++ Ltl+h+kSHLQkYRl
  GSBRNA2T00083992001 13 KPRLRWSYELHHRFIDAVNQLGGPNKATPKGLMRFLEIPELTLYHLKSHLQKYRL 67
                         79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.2E-271069IPR009057Homeodomain-like
TIGRFAMsTIGR015571.1E-201367IPR006447Myb domain, plants
SuperFamilySSF466891.24E-141370IPR009057Homeodomain-like
PfamPF143796.8E-19132178IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 218 aa     Download sequence    Send to blast
MDNDKNHKTE EPKPRLRWSY ELHHRFIDAV NQLGGPNKAT PKGLMRFLEI PELTLYHLKS  60
HLQKYRLGIS ERFIGNKQCL FQYKCHFIFL RLILNILIFQ SQECQSQEDL GDQLDIIVTE  120
EKHDEPNNRN LQIKEAVEIQ MEVQKKLHEQ IEMQQQLQVR IEAQGKYLES VLLKAQETLS  180
GYKSFNLYAV ASMANRNCLS SSFSALTQAD EDNEVEE*
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00083992001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1893856e-90AC189385.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB052E19, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009110746.11e-128PREDICTED: myb family transcription factor APL-like
TrEMBLA0A078I6C11e-161A0A078I6C1_BRANA; BnaA08g19900D protein
STRINGBra016289.1-P1e-131(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM38782759
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69580.22e-72G2-like family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]